PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G155700.1
Common NameB456_001G155700, LOC105796076
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 84aa    MW: 9895.28 Da    PI: 8.2185
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G155700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.7e-082968445
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding  4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                        ++++E++l+++  k+ G + W++Ia +++ gR ++++  +w 
  Gorai.001G155700.1 29 MSEQEEDLIYRMYKLVGDK-WALIAGRIP-GRKAEEIERFWI 68
                        79***************99.*********.*********995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.2E-52573IPR001005SANT/Myb domain
CDDcd001673.08E-52867No hitNo description
PfamPF002491.7E-72968IPR001005SANT/Myb domain
SuperFamilySSF466894.7E-73068IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.6E-103068IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010091Biological Processtrichome branching
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 84 aa     Download sequence    Send to blast
MDGRRRKQPK TSGCCSEEVS SIEWEFINMS EQEEDLIYRM YKLVGDKWAL IAGRIPGRKA  60
EEIERFWIMR HGEGFANRRR ELS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9973991e-134JN997399.1 Gossypium arboreum caprice (CPC) mRNA, complete cds.
GenBankJN9974021e-134JN997402.1 Gossypium hirsutum CPC-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012481169.12e-55PREDICTED: transcription factor CPC-like
SwissprotQ8GV051e-39TRY_ARATH; Transcription factor TRY
TrEMBLA0A0D2QR362e-55A0A0D2QR36_G
STRINGPOPTR_0014s09200.13e-45(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53200.16e-41MYB_related family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]